Dataset for protein Noxa of organism Rhinolophus ferrumequinum

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A671EYM5_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=PMAIP1 (length=119 residues).
VGSCFSPEPEVLGYPLSAVSSRLPSGPARPPGAQLASCRPQGATQGWGTEFPGGLQQTSRRLLAEMPGKKARKNAQPSPT
RAPAELEVECAIQFRRIGDKLSFRQKLLNLISKLFRSGT
© 1998-2020Legal notice