Dataset for protein Bik of organism Rattus norvegicus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|Q925D2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Rattus norvegicus GN=BIK (length=158 residues).
MSEARLMARDIIKTLLHDQVPQPAVVSGAPSMKEPVGVEDVSPVRDLDFMRCLESRNQVALRLACIGDEMDRCLRSPRLV
QLPGIAMHRLAATYSQTGVRGIFRSLIGSLTNLRENIWSWRVFTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWHLQLQ
>gnl|bcl2dbpro|Q925D2_BIK-02 BCL2-interacting killer protein OS=[Eukaryota] Rattus norvegicus GN=BIK (length=191 residues).
MASAPVSARTWEFASVPPLGILGSVPFLPRSEDMSEARLMARDIIKTLLHDQVPQPAVVSGAPSMKEPVGVEDVSPVRDL
DFMRCLESRNQVALRLACIGDEMDRCLRSPRLVQLPGIAMHRLAATYSQTGVRGIFRSLIGSLTNLRENIWSWRVFTPGA
WVSPDQDPGQLFPMVLLVFLLLGGAWHLQLQ
© 1998-2022Legal notice