Dataset for protein Bim of organism Rattus norvegicus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|O88498_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2L11 (length=93 residues).
MSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRAFANDYREAEDHPQMVILQ
LLRFIFRLVWRRH
© 1998-2022Legal notice