Dataset for protein Noxa of organism Pseudonaja textilis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A670ZS96_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Pseudonaja textilis GN=PMAIP1 (length=49 residues).
RGGKERQRTAASTEECSVMIALQLRRIGDKWNLRQRILNLFSKLFCPGT
© 1998-2020Legal notice