Dataset for protein Bim of organism Pseudonaja textilis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A670Y3D3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Pseudonaja textilis GN=BCL2L11 (length=197 residues).
MAKQSSDLNSECEREGGQLQPAERPAQPHHLRPGAPTSLQTEYQGNHLGERDSSSPGSPQGPLAPPSSPSPFATRSPLFM
FVRRSPLLSRSSSGYFSFDIDRSPAPMNCDKATQTPSPPCQAINHYLSAMASRWQSRPIPEDMQPEIWIAQELRRIGDEF
NASYCPRRGLLDYQGVNHQIIILRLLHYIVRFIWRMQ
© 1998-2020Legal notice