Dataset for protein Bad of organism Pseudonaja textilis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A670YRG7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Pseudonaja textilis GN=BAD (length=103 residues).
LELRRRIGSDQLDSETSDEVGAFRARSRSAPPILWAAQRYGRELRRMSDEFHGLPRPKSAGTCSHMDRPPPSWKDTLRSW
WLYSGSDIMALSRFSPSAPSTLN
© 1998-2020Legal notice