Dataset for protein Bmf of organism Prolemur simus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C8ZAV1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Prolemur simus GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPAEGQWQHRAEVQIARKLQRIADQFHRLHVQQHQQNQNRVW
WQILLFLHNLALNGEENRNGAGPR
© 1998-2022Legal notice