Dataset for protein Noxa of organism Podarcis muralis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A670IXL8_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Podarcis muralis GN=PMAIP1 (length=56 residues).
MPSQRLELQLPPAPASTTNDSEAVRECALQLRRMGDKWNLRQKILNLISKLFCPET
© 1998-2020Legal notice