Dataset for protein Bad of organism Podarcis muralis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A670JUY4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Podarcis muralis GN=BAD (length=91 residues).
LEFNNIRKDWTLALGTFRARSRSAPPILWAAQRYGRELRRMSDEFHGELQKLPRPKSAGTATQMRRTLGWKEVLQSWWRR
NSPGNGPRSPP
© 1998-2020Legal notice