Dataset for protein Puma of organism Piliocolobus tephrosceles

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C9GX27_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Piliocolobus tephrosceles GN=BBC3 (length=269 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRVSAGG
GVDGRWDFPPEEGAAGGPRQMCCSCCPARLGRSADRQVGGEWVGGIARPQSRPGTPRRGWHSRSPSQGQGQGRELGCRGD
QRRARSPRPRGLRASLGGAAHISRAIYSW
© 1998-2022Legal notice