Dataset for protein Bad of organism Physeter macrocephalus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2Y9EHU3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Physeter macrocephalus GN=BAD (length=168 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGDKPPGPSKHRQTAPGLLGEAGHQQGQPASSSHHGGTGAVDTRSRHSSYSAGT
EDDEGTEEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHGSFKGLPRPKSAGTATQMRQSPSWTRFLQSWWNRNLG
RGGPAPSQ
© 1998-2020Legal notice