Dataset for protein Hrk of organism Phocoena sinus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C9E480_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Phocoena sinus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPSALPTYWPWLCAAAQVAA
LAAWLLGRRNL
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice