Dataset for protein Noxa of organism Phasianus colchicus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A669QIC6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Phasianus colchicus GN=PMAIP1 (length=114 residues).
MPGRTIRKPAPPAAPAGRERRREAGLNFFTGVDTGKKQAFPFFFSFFFSTVFFPSPISLSGKDLVRIKSPSPCACFAERD
AVAECALELRRIGDKADLRQKVLNLIAKLFCPKT
© 1998-2020Legal notice