Dataset for protein Bmf of organism Peromyscus maniculatus bairdii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A6I9LHF8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Peromyscus maniculatus bairdii GN=BMF (length=270 residues).
MPGAGVFWKQYRAVRRGLLSRQLAPAAAAALARTTASRRSPLEFAPSFPIECGRQAPRVLVTLDPGAEPWHHDSEAETLS
WSHPGEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLS
PASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQ
NRDRAWWQVFLFLQNLALNREENREGAGPW
© 1998-2022Legal notice