Dataset for protein Bim of organism Pavo cristatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C9EIW6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Pavo cristatus GN=BCL2L11 (length=229 residues).
MAKQPPEAKAPRDRRAGRLPPGEGPGPAVPLRPGAPAALPGAARPASPGSPGPFAIRSPLFFFVRRSPLLPRSSSGYFSF
EAERSPAPMSCDKATQTPSPPCQAVSHYLSAMASRWRSHSLAEEIQPEIWIAQELRRIGDEFNASYCPRRVIFLFLLSIS
LRTASKREKLNHIWKLALWQVFCSLKCRKGCAGGCRLLPPRHSIHSASPFELGPEIFGCRGFIHGTESQ
© 1998-2022Legal notice