Dataset for protein Noxa of organism Papio anubis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2I3M5R0_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Papio anubis GN=PMAIP1 (length=135 residues).
MPGKKARKNAQPSPTRAQAGPGTAGTAGTARDQAGFGIGMQLHFTRSKKLVSSSPLALPRGHEEQVQVARSRVCYSTQEI
WRQTELPAETSESDSQTLLLRNLTASKTCIGGLQKRLFLRRCTLHQFEERLHCNW
© 1998-2023Legal notice