Dataset for protein Puma of organism Papio anubis

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2I3N2Z9_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Papio anubis GN=BBC3 (length=261 residues).
IKFGVGSARACPCQVPRASSATWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGSVLRPLRARPGC
RPRRPRPAARCLPLRPHRPTRRHRRPGGPPLAWGSPQPAPRPTPGRSSALALAGGAAPGVARAQRPGGPGGRSHPGGPGS
PWGGGTVGPGDRGPAAADGGRPQRAVRAAETRGAAATPPLALEGPVQSHHGTPALTQGPQSPRNGAQLGACTRPVDVRDL
GGRPLPPPDTLASAGDFLCTM
>gnl|bcl2dbpro|A0A2I3N2Z9_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Papio anubis GN=BBC3 (length=131 residues).
IKFGVGSARACPCQVPRASSATWVPCQICGPQPSLLLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
© 1998-2022Legal notice