Dataset for protein Bad of organism Papio anubis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2I3MFC0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Papio anubis GN=BAD (length=163 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDKPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGRAWYSPSWESEDSENPS
ARMLAEASAPMSAPATDSEAQHAENVKLKALGLWRRGVATAPTPRGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAAS
SGG
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice