Dataset for protein Bad of organism Panthera tigris altaica

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C9J6L6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Panthera tigris altaica GN=BAD (length=169 residues).
MFQIPEFEPSEQEDSSPTDRGLGPSPTGDRPRGPGKHQRTAPGLLGEAGHQQGQPASSNHHGGAGAVETRSRHSSYPAGT
EEDEGTEEEEPSPFRGRSRSAPPNLWAALRYGRELRRMSDEFQGSFKKGLPRPKSAGTATQMRQSPSWTRFIQSWWDRNL
GRGGSAPSQ
© 1998-2022Legal notice