Dataset for protein Unclassified of organism Oryzias latipes

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3P9JZK2_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes (length=150 residues).
MDDEEDDMSRPVSQLWGTPFRDVKFQERAIRISAGEDVTAMPASQENSTDVPSCRFRWQPRMPFHGEAPASREDRGQDDE
VAERPEERPEVSVEVQIGRKLREIGDKFNQDHFMRHQRQNFPVWMRLTAALLGFLFPREALVPRLRGELR
© 1998-2020Legal notice