Dataset for protein Puma of organism Oryctolagus cuniculus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A5F9DGT6_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BBC3 (length=182 residues).
MARARQEGSSPEPVEGLARDGPRPLPAWSPGALGRVLRPSASGKSLLESDCSPRAAAGGLLPASSHSGFPAPLPRPGPPR
PPRGSQLEGGPVTGVVPCPAPRGPLEGVPTPAAPGVWGEEEQWAREIVAQLRWMAYDLYAQYERRQEEQQRHRPSPWRVL
YNLLMGLLPLPRGPGAPEMEPN
© 1998-2020Legal notice