Dataset for protein Unclassified of organism Ornithorhynchus anatinus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A6I8PDD6_uncHRK-01 Putative Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Ornithorhynchus anatinus (length=114 residues).
MCTVPRGGGGCGGGCGGEGGVGGGCGWGSGSAARVTVARLKALGDELHERTAARRRRLGRGGRGRGVLPSLPSSLPSLPS
LPSSLPSSPPGWAWLCAAAQVAVLAAWLLRRRNL
© 1998-2020Legal notice