Dataset for protein Bmf of organism Ornithorhynchus anatinus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A6I8NF73_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ornithorhynchus anatinus GN=BMF (length=216 residues).
MKWPWPGRRYGCARSLSAGRMELSQYEEELEELTGLEELEDDVFHPETPVAESLAQPGGPAPAAPLTPGQPYSYLVGQLP
LFPLAPCCGPGLRTLSQEDKTTQTLSPAAPSQGVMLPCGVTEEPRRLFYGHAGYRLSSLTSFPGDPSLGEEPPEAPWERR
PEMQVARKLQCIADQFHRLHTQRHQRNRNHVWWRVLPLLHNLALGMEENGQGGGPR
© 1998-2020Legal notice