Dataset for protein Unclassified of organism Oreochromis aureus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A668RHT7_uncBCL2L11-01 Putative BCL2-like 11 protein OS=[Eukaryota] Oreochromis aureus (length=231 residues).
LAKKGIKSSRVCKIQLSDISPAVLMGYLETKSRPASGSLEYVRLKLQTKQQREAVGSQTSRLNRGSTGGGEPDSPSWCRT
PKSFDVFQSRTIFRFPRRSSSGYFSSDCDSLPSSPLSPKPVMSDKAIQTPSPTGQVLIHALQRMGEVRGEGPGTQHGEHR
LFMYNSRINVSARTVTNDSEKMNKNILRMFCYLVSYLRCVCFHPFLTVELSHEREPFFHYSDVLCLLFSHE
© 1998-2020Legal notice