Dataset for protein Bmf of organism Oreochromis aureus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A668TQU8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oreochromis aureus GN=BMF (length=123 residues).
MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGECYCTDLTPARRQEIAEQQNSM
ERLPRQQPAARSVEACIGQKLQLIGDQFHWERLQLVRRMDAFG
© 1998-2020Legal notice