Dataset for protein Bad of organism Oreochromis aureus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A668V3Q4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oreochromis aureus GN=BAD (length=158 residues).
MAANFTISDSESETSEEVGEEENQQPAGQDQESKPQTLALPVIKTTGAGRLRLNSESHTSSVARDEDLMARGEDEVCTPT
EGDPFRRRSKSAPPALWAAKKYGQKLRRMSDEFDSLLDKGEMKLKKLHHSKTWWSYLFSHQETEGENNHLENHNQRTE
© 1998-2020Legal notice