Dataset for protein Unclassified of organism Nothoprocta perdicaria

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C6Z5C2_uncBCL2L11-01 Putative BCL2-like 11 protein OS=[Eukaryota] Nothoprocta perdicaria (length=88 residues).
LGQARPPEIWIAQELRRIGDEFNASYCPRRVTCRFFFSVSCLERAMLRLPVPLTQEKAFPQLLVRIVFRSNLSCSPLSRA
FFPCVCWP
© 1998-2022Legal notice