Dataset for protein classical BH3-containing proteins of organism Nothoprocta perdicaria

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C6Z034_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Nothoprocta perdicaria GN=BMF (length=190 residues).
MDRPSYMEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQTCLRRFQLFPLTHCCGPGSRHPEQQDKATQTLSP
SSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPRLQEQPQEAQREARAEVQIARKLQCIADQFHRLHIQRHQQ
NRNQVWWQLLLFLHNLALNVEANRNRTGQR
© 1998-2022Legal notice