Dataset for protein Unclassified of organism Neogobius melanostomus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C6ULE5_uncBCL2L11-01 Putative BCL2-like 11 protein OS=[Eukaryota] Neogobius melanostomus (length=165 residues).
KPPSSSQETQGTIPDVAGEWRKARRPADKPEWRPRRVWEQRRAVLLCSRQPRRAPYQATRSTRRSSSGYFSYDSESQPGS
PLSPRPLTADTATQTASPSAQVIEHAVNSLAAAARGHGESAHQQQHGERERCVKGRRLSKIAICLILKLKLQYAYLPFCV
SRGKL
© 1998-2022Legal notice