Dataset for protein Bmf of organism Neogobius melanostomus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C6U3U8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Neogobius melanostomus GN=BMF (length=167 residues).
MEDEEDDVFEPELQCWHSTFRQIKCEDRATQTPGPALAPSKGMLPFGVAEEPRPLFYGNAGFRLHFPAHFELVEDQETSG
PLQDGEMQNGVDQPPRQLPAAHSVEACIGQKLQLIGDQFHRDHLRLYQRHQRNQGPVWWRLAAALLSLLLDRGGFMAGGG
RGAAGQR
© 1998-2022Legal notice