Dataset for protein Bim of organism Naja naja

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C6VGF4_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Naja naja GN=BCL2L11 (length=202 residues).
MAKQSSDLNSECEREGGQLQPAERPAQPHHLRPGAPTSLQTEYQGNHLGERDSSSPGSPQGPLAPPSSPSPFATRSPLFM
FVRRSPLLSRSSSGYFSFDIDRSPAPMNCDKATQTPSPPCQAINHYLSAMGKQEHASRWQSRPIPEDMQPEIWIAQELRR
IGDEFNASYCPRRGLLDYQGVNHQIIILRLLHYIVRFIWRMQ
© 1998-2022Legal notice