Dataset for protein Bmf of organism Myripristis murdjan

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A667YNR9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Myripristis murdjan GN=BMF (length=163 residues).
MDDEEDDVFEPDLHCWRTTFREIKCEDRGTQTPGPALTLANGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEARQ
QEREEEQNGMEQRPRQQPVARSVEARIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLASALLNLLFDRGAFAGGGGA
GRR
© 1998-2020Legal notice