Dataset for protein Bad of organism Myripristis murdjan

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A667ZNC6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Myripristis murdjan GN=BAD (length=163 residues).
MASFTISDGESDPSEEVGESETDKSLNHQEQNHHLGHALTTPELRMSASGRVRLNSESHVSTVSKDEELLARGEGEDGDG
APFRGRSQSAPPALWAAKKYGRQLRRMSDEFDSLLDKGEMKRVRSAGTAKQMQHSKSWWNYLFSHQETEGETSHHENHSN
RTE
© 1998-2020Legal notice