Dataset for protein Noxa of organism Mus spicilegus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C6HML5_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Mus spicilegus GN=PMAIP1 (length=103 residues).
MPRRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKGRMRSPSPTRVPADLKDECAQLRR
IGDKVNLRQKLLNLISKLFNLVT
© 1998-2022Legal notice