Dataset for protein Puma of organism Mus spicilegus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C6HHE2_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Mus spicilegus GN=BBC3 (length=343 residues).
MGFGLARAPWWLVRSGRSVAPGSLESPESHCGRVGVGGWHRGSATPRARARRGRRQGAAEAVAPAGGGCAPATAGYWPRA
RWAGGAAGRWGGGCTPRQLWGGGGDRACGAVDLQVSRLGVCARVWLPSLYPYTEMLAFVTRRGVCAPGSAMARARQEGSS
PEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGHRSRPRGPRP
DGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQHRHRPSPWRV
MYNLFMGLLPLPRDPGAPEMEPN
© 1998-2022Legal notice