Dataset for protein Bmf of organism Moschus moschiferus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C6CWP8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Moschus moschiferus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQHQQNRNRVW
WQILLFLHNVALNGDENRNGAGPR
© 1998-2022Legal notice