Dataset for protein Bad of organism Moschus moschiferus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C6FXQ6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Moschus moschiferus GN=BAD (length=168 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGDGPPGLSKHWLTAPGLLGEAGHQQGQSAGSSHHGGTGAVETRSRHSSYPAGP
EDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLG
RGGSAPSQ
© 1998-2022Legal notice