Dataset for protein Bmf of organism Monodon monoceros

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C6B0J8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Monodon monoceros GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPAEGQWQHRAEVQIARKLQRIADQFHRLHMQQHQQNRNRVW
WQILLFLHNLALNGDENRNGAGPR
© 1998-2023Legal notice