Dataset for protein Bad of organism Monodelphis domestica

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A5F8GA49_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Monodelphis domestica GN=BAD (length=212 residues).
MTVSLTQATGAGLPPKQERGGGGGESPGAEHRDLAAAPRESETPSWPDDASRPVSMFQIPEFEPGEQEDGSERAPGQPGG
PGRRSSAAPGAQRHEGAGDRRPRLISYPPLREGPAVEVGPEAGAQAERAEAEEDRGLFRSRSSSAPPILWAARRYGSELR
RMSDEFDCSFKGLPRPKSAGTASQMRRSHGWTRTVQSWFGRNLGKGGAGPSH
© 1998-2020Legal notice