Dataset for protein Bim of organism Microcebus murinus

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A8B7EUP7_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L11 (length=200 residues).
MAKQPSDVGSECDQEGGQLQPVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDE
FNAYYSRRVFLNNYQADEDHPQMVILRLLHYIVRLIWRRH
>gnl|bcl2dbpro|A0A8B7EUP7_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L11 (length=135 residues).
MAKQPSDVGSECDQEGGQLQPVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A8B7EUP7_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L11 (length=174 residues).
MAKQPSDVGSECDQEGGQLQPVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDE
FNAYYSRRMPLPSD
>gnl|bcl2dbpro|A0A8B7EUP7_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L11 (length=140 residues).
MAKQPSDVGSECDQEGGQLQPVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A8B7EUP7_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L11 (length=87 residues).
MAKQPSDVGSECDQEGGQLQPVERPPQLRPGAPTSLQTEPQASMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYSRRLA
KRLVPSI
>gnl|bcl2dbpro|A0A8B7EUP7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L11 (length=200 residues).
MAKQPSDVGSECDQEGGQLQPVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDE
FNAYYSRRVFLNNYQADEDHPQMVILRLLHYIVRLIWRRH
>gnl|bcl2dbpro|A0A8B7EUP7_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L11 (length=140 residues).
MAKQPSDVGSECDQEGGQLQPVERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAE
PADMRPEIWIAQELRRIGDEFNAYYSRRVFLNNYQADEDHPQMVILRLLHYIVRLIWRRH
© 1998-2022Legal notice