Dataset for protein Unclassified of organism Melopsittacus undulatus

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A8V5FZD5_uncBCL2L11-01 Putative BCL2-like 11 protein OS=[Eukaryota] Melopsittacus undulatus (length=76 residues).
DLKAPPAPTPPELWIAQELRRIGDEFNASSCPRRVTHIPHSHCFTSRMHGILYGKHGILYGNVQLLKGRPWLAPVA
>gnl|bcl2dbpro|A0A8V5GNR1_uncBAD-01 Putative BCL2-associated agonist of cell death protein OS=[Eukaryota] Melopsittacus undulatus (length=79 residues).
MFSLEEFPEDPGVRSRSAPPALWAARRFGRQLRRMSDEFQQEMLPRANSAGGTRSWREALRRWWGAPPPPGPGPPRPPP
© 1998-2024Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice