Dataset for protein Noxa of organism Meleagris gallopavo

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A803YIP1_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Meleagris gallopavo GN=PMAIP1 (length=61 residues).
LSGKDLVRIKSPSPCACSAERDAVAECALELRKIGDKADLQQKVLNLIAKLFCPKKPRPRC
© 1998-2022Legal notice