Dataset for protein Bmf of organism Marmota marmota marmota

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C6A5T3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Marmota marmota marmota GN=BMF (length=189 residues).
VFPEEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQN
RNRVWWQILLFLHNLALNGDENRDRAGPR
© 1998-2022Legal notice