Dataset for protein Bim of organism Marmota marmota marmota

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C5YNZ8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Marmota marmota marmota GN=BCL2L11 (length=195 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPEGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNLY
YPRRVFFNNYQPEDHPQMVILRLLRCIIRLVWRMH
>gnl|bcl2dbpro|A0A8C5YNZ8_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Marmota marmota marmota GN=BCL2L11 (length=139 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAE
PADMRPEIWIAQELRRIGDEFNLYYPRRVFFNNYQPEDHPQMVILRLLRCIIRLVWRMH
© 1998-2022Legal notice