Dataset for protein Bad of organism Marmota marmota marmota

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C5Z4I8_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Marmota marmota marmota GN=BAD (length=170 residues).
MFQIPEFEPSEQEDSSSAEGGLGPSPAGDRPGPYKNQPPGCGLAPGLPRDTGHQQRQATSSSNHGGAGATETRSRHSSYP
ADTDLDEEMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPRSAGTASQMRQSSSWTRFIQSWWDRN
LGRRGSAPSQ
© 1998-2022Legal notice