Dataset for protein Bik of organism Macaca mulatta

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F6SUD3_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Macaca mulatta GN=BIK (length=160 residues).
MSGVRPISRDTLMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFNPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQMDDIRDVLRSFMDGFTTLRENIMRFWRSPNPRSWVSREQVLLVLLLLLALLLALLSGGLHLLLK
© 1998-2020Legal notice