Dataset for protein Noxa of organism Lynx canadensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A667HYB7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Lynx canadensis GN=PMAIP1 (length=123 residues).
EESAGAGRRSDLRGARASLSSLVELGPAAPVRPVPPRACSSRAAAPRCSGWGTENPGLLRHGGRRPLAEMPGKRTRKSAQ
PSPARAPAEPEVECAMQLRRFGDKLNFRQKLMNLISKLFRSGT
© 1998-2020Legal notice