Dataset for protein Bmf of organism Lynx canadensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A667H967_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Lynx canadensis GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRRRVW
WQILLFLHNLALNAEENRNGAGPR
© 1998-2020Legal notice