Dataset for protein Unclassified of organism Leptobrachium leishanense

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C5LNA1_uncHRK-01 Putative Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Leptobrachium leishanense (length=84 residues).
MCPLPFHASLPEVCVCTSERPGGLCSGVQVTAARLRMVGDQLQELTVRKKSSMGRKRLCTCFYLLYTATHLAALALLVQG
RRNL
© 1998-2022Legal notice