Dataset for protein Bad of organism Leptobrachium leishanense

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C5QUK0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Leptobrachium leishanense GN=BAD (length=151 residues).
MAGSVPDTIFSIEKFDSDEQGVFHSSSDPPSTSTCKVSRSSPNLQRQRGKEARFRTESASEPVTETDHVAELRYRSRSRS
APSSVLVAARYGRELRRMSDEFDLTFTGLPRPKSAGAASEMTESKSFKEMFMSFWGRRKSKGKPDSTDETS
© 1998-2022Legal notice